DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and Eci2

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_001103801.1 Gene:Eci2 / 23986 MGIID:1346064 Length:391 Species:Mus musculus


Alignment Length:280 Identity:60/280 - (21%)
Similarity:111/280 - (39%) Gaps:42/280 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SAVGQISRQQLLQNKCTRALPISAQLLQRRRLMSTNPAPVANKH------LHTKVV-----NGVL 61
            :|:|.:.::...||.......:|          |::.||...|.      ..:|.:     :|:.
Mouse    95 NALGSLPKETARQNYVDLVSSLS----------SSSEAPSQGKRGADEKARESKDILVTSEDGIT 149

  Fly    62 VIKIDSPNAKVNSLGSEVSDEFERVIKDLETNPAVNSAVLISGKPGCFVAGADI-GMLEACQTAE 125
            .|..:.|..| |::..::..:....:|:..|:..|  ..:.:|....:.:|.|: ....|....|
Mouse   150 KITFNRPTKK-NAISFQMYRDIILALKNASTDNTV--MAVFTGTGDYYCSGNDLTNFTSATGGIE 211

  Fly   126 EATLISHGAQVMFDRMER---SKKPIVAAISGVCLGGGLELALACHYRIATKDSKTKLGLPEVML 187
            ||.  |:||.::.|.:..   ..||:||.::|..:|..:.| |.....:...|..| ...|...|
Mouse   212 EAA--SNGAVLLRDFVNSFIDFPKPLVAVVNGPAVGISVTL-LGLFDAVFASDRAT-FHTPFSQL 272

  Fly   188 GLLPGGGGTVRLPKLTSVPTALDMELTGKQVRADRAKRLGIVDLLVDPLGPGLQPAEQNTIEYLE 252
            |..|....:...||:.....|.:|.|.||::.|..|...|:|          .:...::|.|...
Mouse   273 GQSPEACSSYTFPKMMGSAKAAEMLLFGKKLTAREAWAQGLV----------TEVFPESTFETEV 327

  Fly   253 KTAVQVANDLASGKLRVNRE 272
            .|.::....|....:|:::|
Mouse   328 WTRLKTYAKLPPNAMRISKE 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 55/250 (22%)
crotonase-like 52..235 CDD:119339 45/191 (24%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
Eci2NP_001103801.1 ACBP 38..113 CDD:279259 4/17 (24%)
Acyl-CoA binding. /evidence=ECO:0000250 64..68
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..136 5/29 (17%)
crotonase-like 139..389 CDD:304874 50/226 (22%)
ECH-like 149..319 43/186 (23%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q05871 196..200 1/3 (33%)
Microbody targeting signal. /evidence=ECO:0000255 389..391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.