DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and B0272.4

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_509583.1 Gene:B0272.4 / 181892 WormBaseID:WBGene00007130 Length:255 Species:Caenorhabditis elegans


Alignment Length:266 Identity:59/266 - (22%)
Similarity:110/266 - (41%) Gaps:46/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TKVVNGVLVIKIDSPNAKVNSLGSEVSDEFERVIKDLETNPAVNSAVLISGKPGCFVAGADIGML 118
            |:..|.||.:.::.|. |.|:|..::..:...|..|...:..:...|...||...:.||:|.   
 Worm     8 TERKNNVLWVTLNRPK-KFNALTRQMFLDLCTVFNDAADDDDIAFVVFTGGKGKYYCAGSDF--- 68

  Fly   119 EACQTAEEATLI---SHGAQVMFDRMERSKKPIVAAISGVCLG------GGLELALACHYRIATK 174
               ..||.:||.   .||.::..|.:....|||:|.::|..:|      |.::..:|.       
 Worm    69 ---SPAELSTLTDIQEHGYKLFVDILIAFPKPIIALVNGHAVGVSVTMLGVMDAVIAI------- 123

  Fly   175 DSKTKLGLPEVMLGLLPGGGGTVRLPKLTSVPTALDMELTGKQVRADRAKRLGIVDLLVDPLGPG 239
            |:.| ...|...:|:.|....:..||::.....|..:.:..::..|..|...|:|..::      
 Worm   124 DTAT-FATPFADIGVCPEACSSYTLPRIMGHQKAAALMMFSEKFTAHEAHIAGLVTQIL------ 181

  Fly   240 LQPAEQNTIEYLEKTAVQVANDLASGKLRVNREKSGLVSKIQSFVMDTDFVKNKIFDTARKQVLK 304
              ||..     .||.|.::.:..:  ||      |.:..|:...:|.|..:|:::....||:.:.
 Worm   182 --PAAT-----FEKDAKKIIDRYS--KL------SPITMKVAKELMRTTQIKDELLTVNRKEQVH 231

  Fly   305 ASNGLY 310
            . ||::
 Worm   232 L-NGMF 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 59/266 (22%)
crotonase-like 52..235 CDD:119339 43/189 (23%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
B0272.4NP_509583.1 crotonase-like 6..196 CDD:119339 48/215 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.