DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and Cdyl

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_034011.1 Gene:Cdyl / 12593 MGIID:1339956 Length:593 Species:Mus musculus


Alignment Length:224 Identity:56/224 - (25%)
Similarity:94/224 - (41%) Gaps:22/224 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NGVLVIKIDSPNAKVNSLGSEVSDEFERVIKDLETNPAVNS-AVLISGKPGCFVAGADIGMLEAC 121
            :|...|.:.:.:::.|||..||..|.:..   |.|..|.:| .||:|.....|..|.|.......
Mouse   345 DGFTHILLSTKSSENNSLNPEVMKEVQSA---LSTAAADDSKLVLLSAVGSVFCCGLDFIYFIRR 406

  Fly   122 QTAE---EATLISHGAQVMFDRMERSKKPIVAAISGVCLGGGLELALACHYRIATKDSKTKLGLP 183
            .|.:   |:|.::...:...:...:.||||:.|::|..:|.|..:...|.  :...:.|.....|
Mouse   407 LTDDRKRESTKMADAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCD--VVWANEKAWFQTP 469

  Fly   184 EVMLGLLPGGGGTVRLPKLTSVPTALDMELTGKQVRADRAKRLGIVDLLVDPLGPGLQPAEQNTI 248
            ....|..|.|..||..||:....:|.:|..:|:::.|..|...|:|..:   ..||         
Mouse   470 YTTFGQSPDGCSTVMFPKIMGGASANEMLFSGRKLTAQEACGKGLVSQV---FWPG--------- 522

  Fly   249 EYLEKTAVQVANDLASGKLRVNREKSGLV 277
            .:.::..|:: .:|||....|..|...||
Mouse   523 TFTQEVMVRI-KELASCNPVVLEESKALV 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 56/224 (25%)
crotonase-like 52..235 CDD:119339 46/180 (26%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
CdylNP_034011.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
CHROMO 55..109 CDD:214605
Interaction with EZH2. /evidence=ECO:0000250|UniProtKB:Q9Y232 56..304
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..158
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..223
crotonase-like 339..535 CDD:119339 49/207 (24%)
Acetyl-CoA-binding domain. /evidence=ECO:0000255 357..589 54/212 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.