DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and Auh

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_057918.2 Gene:Auh / 11992 MGIID:1338011 Length:314 Species:Mus musculus


Alignment Length:330 Identity:80/330 - (24%)
Similarity:138/330 - (41%) Gaps:73/330 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KHLHTKVVNGVLVIKIDSPNAKVNSLGSEVSDEFERVIKDLETNPAVNSAVLISGKPGCFVAGAD 114
            :||..: ..|::|:.|:....| |:|...:.....:.:..|:::..|.:.::.|..||.|.||||
Mouse    55 RHLEEE-NRGIVVLGINRAYGK-NALSKNLLKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGAD 117

  Fly   115 IGMLEACQTAEEATLISHGAQVMFDRMERSKKPIVAAISGVCLGGGLELALACHYRIATKDSKTK 179
            :.......::|....:|....|:.| :.....|.:|||.|:.|||||||||||..|:|.  |..|
Mouse   118 LKERAKMHSSEVGPFVSKIRSVIND-IANLPVPTIAAIDGLALGGGLELALACDIRVAA--SSAK 179

  Fly   180 LGLPEVMLGLLPGGGGTVRLPKLTSVPTALDMELTGKQVRADRAKRLGIVDLLVDPLGPGLQPAE 244
            :||.|..|.::||||||.|||:...:..|.::..:.:.:....||.:|::..::          |
Mouse   180 MGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGQEAKAVGLISHVL----------E 234

  Fly   245 QNTIEYLEKTAVQVANDLASGKLRVNREKSGLVSKIQSFVMDTDFVKNKIFDTARKQVLKASNGL 309
            ||                                      .:.|....|..|.||:.:.:.    
Mouse   235 QN--------------------------------------QEGDAAYRKALDLAREFLPQG---- 257

  Fly   310 YPAPLKILDV-IRAGVDKGTDAGYEAERKGFGELSATPES-KGLIALFRGQTECKKNRFGKPERP 372
             |..:::..: |..|::.....|...|...:.:..:|.:. :||:|.             |.:||
Mouse   258 -PVAMRVAKLAINQGMEVDLVTGLAIEEACYAQTISTKDRLEGLLAF-------------KEKRP 308

  Fly   373 VKTVG 377
            .:..|
Mouse   309 PRYKG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 80/330 (24%)
crotonase-like 52..235 CDD:119339 58/182 (32%)
3HCDH_N 375..553 CDD:280833 1/3 (33%)
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
AuhNP_057918.2 crotonase-like 61..314 CDD:304874 78/323 (24%)
RNA-binding. /evidence=ECO:0000250|UniProtKB:Q13825 80..94 0/13 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.