DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and ECI2

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_996667.2 Gene:ECI2 / 10455 HGNCID:14601 Length:394 Species:Homo sapiens


Alignment Length:283 Identity:61/283 - (21%)
Similarity:113/283 - (39%) Gaps:47/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SAVGQISRQQLLQN------KCTRALPISAQLLQRRRLMSTNPAPVANKHLHTKVV---NGVLVI 63
            :|:|.:.::...||      ..:.:|..|:|:.......||.        ..|.||   :|:..|
Human    97 NALGSLPKEAARQNYVDLVSSLSPSLESSSQVEPGTDRKSTG--------FETLVVTSEDGITKI 153

  Fly    64 KIDSPNAKVNSLGSEVSDEFERVIKDLETNPAVNSAVLISGKPGCFVAGADI--------GMLEA 120
            ..:.|..| |::.:|:..|..|.:|....:.::  ..:::|....:.:|.|:        |.:|.
Human   154 MFNRPKKK-NAINTEMYHEIMRALKAASKDDSI--ITVLTGNGDYYSSGNDLTNFTDIPPGGVEE 215

  Fly   121 CQTAEEATLISHGAQVMFDRMERSKKPIVAAISGVCLGGGLELALACHYRIATKDSKTKLGLPEV 185
             :....|.|:........|    ..||::|.::|..:|..:.| |.....:...|..| ...|..
Human   216 -KAKNNAVLLREFVGCFID----FPKPLIAVVNGPAVGISVTL-LGLFDAVYASDRAT-FHTPFS 273

  Fly   186 MLGLLPGGGGTVRLPKLTSVPTALDMELTGKQVRADRAKRLGIV-DLLVDPLGPGLQPAEQNTIE 249
            .||..|.|..:...||:.|...|.:|.:.||::.|..|...|:| ::..|           :|.:
Human   274 HLGQSPEGCSSYTFPKIMSPAKATEMLIFGKKLTAGEACAQGLVTEVFPD-----------STFQ 327

  Fly   250 YLEKTAVQVANDLASGKLRVNRE 272
            ....|.::....|....||:::|
Human   328 KEVWTRLKAFAKLPPNALRISKE 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 54/247 (22%)
crotonase-like 52..235 CDD:119339 45/194 (23%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
ECI2NP_996667.2 ACBP 40..113 CDD:279259 4/15 (27%)
Acyl-CoA binding. /evidence=ECO:0000250 66..70
crotonase-like 142..335 CDD:119339 47/213 (22%)
ECH-like 151..322 41/180 (23%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q05871 198..202 1/3 (33%)
Microbody targeting signal. /evidence=ECO:0000255 392..394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.