DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brwl and zgc:152938

DIOPT Version :9

Sequence 1:NP_609298.1 Gene:brwl / 34275 FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001070756.1 Gene:zgc:152938 / 768145 ZFINID:ZDB-GENE-061013-458 Length:292 Species:Danio rerio


Alignment Length:102 Identity:26/102 - (25%)
Similarity:50/102 - (49%) Gaps:12/102 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VNLVRTHKCLYDKKVPEYRNRDNQEKAWVLISKETRESVIHCKERWRNLRACLSRYIK-----QQ 121
            ::||...:.|:|:...:|::.|.:|..|..|:::....|...|.:|:|||   ..||:     |.
Zfish    61 ISLVSDRRELFDQNHIDYKHIDKREALWQEIAEKIGFHVDDVKTKWKNLR---DTYIRKKREDQC 122

  Fly   122 SGSE-PQHKPYYLTEHMAFLLPFLKSSRNSLEGNNSL 157
            :|.: |:.|.   |.....::.||.:|......::|:
Zfish   123 TGEQTPKKKK---TWKFMKMMEFLATSSEQRRVHSSV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brwlNP_609298.1 MADF 60..145 CDD:214738 23/88 (26%)
BESS 356..389 CDD:281011
zgc:152938NP_001070756.1 MADF_DNA_bdg 60..128 CDD:287510 19/69 (28%)
BESS 226..260 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.