DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brwl and CG6683

DIOPT Version :9

Sequence 1:NP_609298.1 Gene:brwl / 34275 FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_648232.1 Gene:CG6683 / 38970 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster


Alignment Length:221 Identity:45/221 - (20%)
Similarity:73/221 - (33%) Gaps:76/221 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 FNIRFVNLVRTHKCLYDKKV---PEYRNRDNQEKAWVLISKETRESVIHCKERWRNLRACLSRYI 118
            |:.|.:.|||.:..||::::   |...::....:.|..|:.........|..||.:|.|...|.:
  Fly     4 FDTRLIELVRANPKLYERELRNAPYEAHKKRHPEIWSSIATSLNSEASACVSRWNHLVAKQRREL 68

  Fly   119 KQQ----SGSEPQHKPYYLTEHMAFLLPFLKSSRNSLEGNNSLATLYQMSQQHLQHQPFLLHPAL 179
            .::    :||:     :.|..|:.||                         || .|.|.      
  Fly    69 AKEKAGGTGSD-----WSLLPHLKFL-------------------------QH-HHHPI------ 96

  Fly   180 HATEEHKYCANTSINNNNNNNDVHNGESMEVLEMKYSISEKDDEETI-DAFD---------PA-V 233
                           |:.|:.|:...      .:|.|....|||:.: :|.|         || .
  Fly    97 ---------------NHRNSGDLSRS------TLKSSDEVNDDEDPLQEAMDEQLAVAGAAPAPP 140

  Fly   234 TNTLGMNRTSSTPTRSSALQGGGGNS 259
            ||.......:....|..||..|.|.:
  Fly   141 TNPAHATPVAQAEKRIEALLEGLGEA 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brwlNP_609298.1 MADF 60..145 CDD:214738 21/91 (23%)
BESS 356..389 CDD:281011
CG6683NP_648232.1 MADF 7..94 CDD:214738 23/117 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.