DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brwl and CG15601

DIOPT Version :10

Sequence 1:NP_609298.1 Gene:brwl / 34275 FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_573058.1 Gene:CG15601 / 32509 FlyBaseID:FBgn0030673 Length:277 Species:Drosophila melanogaster


Alignment Length:109 Identity:24/109 - (22%)
Similarity:51/109 - (46%) Gaps:9/109 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 FVNLVRTHKCLYDKKVPEYRNRDNQEKAWVLISKETR---ESVIHCKERWRNLRACLSRYIK--- 119
            |:...|...|||:..:..|:||.::|:|:..|.:..:   .:|...|.:.:::|...|:.::   
  Fly    14 FLEAYRRQPCLYNTLLDSYKNRVSREEAYGAIIRSLKIPQLTVSDIKLKIKSVRTVYSKELRIWM 78

  Fly   120 --QQSGSEPQHKPYYLTEHMAFLLPF-LKSSRNSLEGNNSLATL 160
              ::.|...:.|.::.....:||... |...:...:.|:|.|.|
  Fly    79 REKELGRTYEPKLFWFRLADSFLRSVSLSHCKRQGKNNSSSAQL 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brwlNP_609298.1 MADF 60..145 CDD:214738 19/92 (21%)
BESS 356..389 CDD:460758
CG15601NP_573058.1 MADF_DNA_bdg 14..101 CDD:463144 17/86 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.