DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brwl and CG4404

DIOPT Version :9

Sequence 1:NP_609298.1 Gene:brwl / 34275 FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster


Alignment Length:371 Identity:89/371 - (23%)
Similarity:145/371 - (39%) Gaps:111/371 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DEDFNIRFVNLVRTHKCLYDKKVPEYRNRDNQEKAWVLISKETRESVIHCKERWRNLRACLSRYI 118
            |..||:|||..|....||::...|.|..:::.::||..::.:.:::|.:|:||||.:|:...|.:
  Fly    11 DPVFNVRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRSL 75

  Fly   119 K---QQSGSEPQHKPYYLTEHMAFLLPFLK--SSRNSLEG-----NNSLATLYQMSQQHLQHQPF 173
            |   .|:|.  ..:.|||::::.||:||.|  |....|.|     ....||..|..:        
  Fly    76 KLARTQTGR--GKRKYYLSKYLQFLVPFTKSRSCHKQLPGMVLRKPGQAATAQQEDE-------- 130

  Fly   174 LLHPALHATEEHKYCANTSINNNNNNNDVHNGE---SMEVLEMKYSISEKDDEETIDAFDPAVTN 235
                .:.|.||.|               |.:||   .::|.|.::..:::.|.|           
  Fly   131 ----VVAAEEEAK---------------VSDGEMPLDVQVSEEEHRRNQEQDRE----------- 165

  Fly   236 TLGMNRTSSTPTRSSALQGGGGNSPARSDTASADSMKNFIPDVQLAETGSQLIYSD-----GGHG 295
                ..|:..|.|..:::....:|.|........|.::.: .|..|..|:.|.:||     .|||
  Fly   166 ----QPTACLPLRLHSIKVEHDSSNANQQLERMVSQQSLV-SVPAAALGNHLGWSDLTQWFKGHG 225

  Fly   296 T---------------PPPLHYHPHSHPHPLTLSMDHHPASYEPGSTKRIKTECEATSTMTNAGS 345
            :               |||        |.|.|                      .|.|..|... 
  Fly   226 SGHHKLTTTTTTPTSPPPP--------PQPAT----------------------SALSVFTGGP- 259

  Fly   346 IYGGLSSSEVADMEFFRSILPDLATLTPQQRRKFKIGILELIDDVV 391
              ||..|...||..|..|:.|.:..:..:|.|||:..::.||||::
  Fly   260 --GGGGSQPDADYSFLISLHPYIKEMNGKQNRKFRQKVVGLIDDIL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brwlNP_609298.1 MADF 60..145 CDD:214738 28/87 (32%)
BESS 356..389 CDD:281011 11/32 (34%)
CG4404NP_572838.2 MADF 17..103 CDD:214738 28/87 (32%)
BESS 267..301 CDD:281011 11/33 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469752
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DZH1
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I4107
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.