DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brwl and CG12155

DIOPT Version :9

Sequence 1:NP_609298.1 Gene:brwl / 34275 FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_572403.1 Gene:CG12155 / 31682 FlyBaseID:FBgn0029957 Length:555 Species:Drosophila melanogaster


Alignment Length:312 Identity:62/312 - (19%)
Similarity:108/312 - (34%) Gaps:108/312 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ADEDFNIRFVNLVRTHKCLYDKKV-PEYRNRDNQEKAWVLISKE--TRESVIHCKERWRNLRACL 114
            |..|..:..:||||.:..||:.|: |..|.|.:....|..::::  .:.:|...:.:|:|||...
  Fly    16 APTDDILTLINLVRQNPVLYNYKLQPNQRRRSDVLNGWQEVAQQIGNKYTVQEVRRKWKNLRDTF 80

  Fly   115 SRY-IKQQSGSEPQHKPYYLTEHMAFL----LPFLKSSRNS---------------LEGNNSLAT 159
            .:| ::.....|.:...:...:.:.||    .|.|||.||:               :.|.|| .|
  Fly    81 HQYRLRTPKYIEGRLSKWRYAKELDFLSKVYQPKLKSHRNTQITYETSGVAGAGGGIGGANS-TT 144

  Fly   160 LYQMSQQHLQHQPF--LLHPALHATEEHKYCANTSINNNNNNND-------VHNGESMEVLEMKY 215
            |           |.  :||...|..::     :..:.:::..:|       .|:|.|...|    
  Fly   145 L-----------PIGAMLHLKQHVDDD-----DDEVMDDDGQSDHDTATLSSHHGTSQITL---- 189

  Fly   216 SISEKDDEETIDAFDPAVTNTLGMNRTSSTPTRSSALQGGGGNSPARSDTASADSMKNFIPDVQL 280
             :|::.:...:.|::..|::                            ||.|..           
  Fly   190 -VSDEAETFILTAYEEGVSD----------------------------DTVSQH----------- 214

  Fly   281 AETGSQLIYSDGGHGTPPPLHYH-PHSHPHPLTLSMDHHPASYEPGSTKRIK 331
                    :....||.....|:| ||.|.|      .||..|...||...|:
  Fly   215 --------HHHHHHGHHQQEHHHQPHHHHH------HHHHQSQHDGSISSIE 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brwlNP_609298.1 MADF 60..145 CDD:214738 21/92 (23%)
BESS 356..389 CDD:281011
CG12155NP_572403.1 MADF 24..112 CDD:214738 20/87 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.