DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brwl and CG45071

DIOPT Version :9

Sequence 1:NP_609298.1 Gene:brwl / 34275 FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_730024.1 Gene:CG45071 / 19834908 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster


Alignment Length:392 Identity:84/392 - (21%)
Similarity:135/392 - (34%) Gaps:104/392 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RFVNLVRTHKCLYDKKVPEYRNRDNQEKAWVLISKETRESVIHCKERWR----NLRACLSRYIKQ 120
            :|::.:.....::::..  :.|:...|:.|..:|...:...|..|.:|:    |.|....|..:.
  Fly    14 QFIHDIEERPAIWNRNF--HCNKAFLEQMWDELSGAHKLPKIVLKAKWKGLRDNFRVEYKRIPRA 76

  Fly   121 QSGS--------EPQHKPYY----LTEHMAFLLPFLKSSRNSLEGNNSLATLYQMSQQHLQHQPF 173
            .:|.        |.:...||    ||:||...||           .|.....:..|||....:..
  Fly    77 DNGDFMVDPATFESKWLHYYALLFLTDHMRHRLP-----------KNEQDQSFYFSQQSEDCEKT 130

  Fly   174 LLHPALHATEEHKYCANTSINNNNNNNDVHNGESMEVLEMKYSISEKDDEETIDAFDPAVTNTLG 238
            ::.|.|         .|..|....::::.::.|.||.   ....||...|||:.. .||...   
  Fly   131 VVEPDL---------TNGLIRRLQDSDEDYDEEEMEA---DGEASEATMEETMPT-PPAAHQ--- 179

  Fly   239 MNRTSSTPTRSSALQGGGGNSPARSDTASADSMKNFIPDVQLAETGSQLIYSDGGHGTPPP---- 299
            ||:.|:||..:.||:       |:.:......:|..:...||.|...:.  .|.....|||    
  Fly   180 MNQVSTTPLATGALR-------AQEEAHQHALIKAGLLRAQLMELEKEA--EDLSRKPPPPQQMT 235

  Fly   300 ---------LHYHPHSHPHPLTLSMDHHPASYEPGSTKRIKTECEATSTMTNAGSIYGGLSSSEV 355
                     |...|.:|..|..:.........:|||...:     |.:|.|:|.|:     ||..
  Fly   236 SPVAPSLQVLVEPPAAHCSPPPMVTTTSAQVQQPGSAAVL-----APATTTSASSV-----SSNG 290

  Fly   356 ADMEFFRSILP---------DLATLTPQQRRKFKIGILELIDDVVTRYPAQDHSNGGGVSGVVNG 411
            |.|...||:.|         .||||                  ......|:|.:...|.:..|.|
  Fly   291 APMGGKRSVSPPPLYNKAHHPLATL------------------AAAHLAAKDRNEDFGPTSAVGG 337

  Fly   412 SG 413
            :|
  Fly   338 NG 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brwlNP_609298.1 MADF 60..145 CDD:214738 21/100 (21%)
BESS 356..389 CDD:281011 9/41 (22%)
CG45071NP_730024.1 MADF 14..106 CDD:214738 18/93 (19%)
BESS 384..418 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.