Sequence 1: | NP_609298.1 | Gene: | brwl / 34275 | FlyBaseID: | FBgn0032130 | Length: | 435 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492729.1 | Gene: | madf-10 / 190925 | WormBaseID: | WBGene00013717 | Length: | 234 | Species: | Caenorhabditis elegans |
Alignment Length: | 204 | Identity: | 45/204 - (22%) |
---|---|---|---|
Similarity: | 78/204 - (38%) | Gaps: | 60/204 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 SSNNHSSEHEERTSNGTTAYNHHSPTGSGSGTAGASIGSTNRVMQADED--FNIRFV-NLVRTHK 69
Fly 70 C--------LYD---KKVPEYRNRD---------NQEKAWVLISKETRESVIHCKERWRNLRACL 114
Fly 115 SRYIKQQSGSEPQHKPYYLTEHMAFL--LPFLKSSRNSLEGNNSLATLYQMSQQHLQH--QPFLL 175
Fly 176 HPALHATEE 184 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
brwl | NP_609298.1 | MADF | 60..145 | CDD:214738 | 24/107 (22%) |
BESS | 356..389 | CDD:281011 | |||
madf-10 | NP_492729.1 | MADF | 53..147 | CDD:214738 | 22/105 (21%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160156206 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0001895 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.930 |