DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brwl and madf-3

DIOPT Version :10

Sequence 1:NP_609298.1 Gene:brwl / 34275 FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_494766.1 Gene:madf-3 / 186755 WormBaseID:WBGene00019218 Length:312 Species:Caenorhabditis elegans


Alignment Length:91 Identity:22/91 - (24%)
Similarity:37/91 - (40%) Gaps:19/91 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 DKRTFKQLVET----LATFLRTNKVVEHFTIEG----FPLAGVRLCTLI--TGLSQ------NTS 164
            |..:||..|..    .:..|..|.|:.:...||    :|....:|...:  .|||:      |:.
 Worm    19 DAGSFKICVSARRSDTSISLPPNFVLSYNDYEGVISSYPNDSKKLNDWLYSAGLSEQYVDIANSQ 83

  Fly   165 LTELNLARCSIGDEGCKALCAEIKFL 190
            |||......|:.|   .::||.:.::
 Worm    84 LTERICKSISMVD---SSVCATLVYM 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brwlNP_609298.1 MADF 60..145 CDD:214738 9/36 (25%)
BESS 356..389 CDD:460758
madf-3NP_494766.1 MADF 9..94 CDD:214738 18/74 (24%)
MADF 122..212 CDD:214738
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.