DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brwl and madf-8

DIOPT Version :9

Sequence 1:NP_609298.1 Gene:brwl / 34275 FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_497739.1 Gene:madf-8 / 183517 WormBaseID:WBGene00008118 Length:300 Species:Caenorhabditis elegans


Alignment Length:176 Identity:29/176 - (16%)
Similarity:74/176 - (42%) Gaps:28/176 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RTHKCLYDKKVPEYRNRDNQEKAWVLISKETRESVIHCKE-----RWRNLRACLSRY----IKQQ 121
            |:.:.:..|...:::..|:..|:  :.::|.|||....|:     ..|:.|...:.|    .|..
 Worm     8 RSGRIVKRKVFADFQQLDDDLKS--ITTEELRESASESKKLRLGPTRRSCRNIPTNYEELKAKTD 70

  Fly   122 SGSEPQHKPYYLTEHMAFLLPFLKSSRNSLEGNNSLATLYQMSQQHLQH------------QPFL 174
            :|..|: ..||...:.:..:|.:.:.....:||:  .|:...|.::.::            :|..
 Worm    71 AGIIPE-TVYYRASNNSMYIPSITADMLKNDGND--LTVQTRSDKYFKYNRVRQSTKIDYAEPEK 132

  Fly   175 LHPALHATEEHKYCANTSINNNNNNNDVHNGESMEVLEMKYSISEK 220
            ::..::|..:.....:..:..:.|:|  .:..:.:.|:::..|.|:
 Worm   133 VYDIIYAVRKRPILWDQRLICHRNSN--LSRRAWDQLDLELGIDEE 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brwlNP_609298.1 MADF 60..145 CDD:214738 18/87 (21%)
BESS 356..389 CDD:281011
madf-8NP_497739.1 MADF 135..219 CDD:214738 6/44 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156214
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.