DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brwl and madf-4

DIOPT Version :9

Sequence 1:NP_609298.1 Gene:brwl / 34275 FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_505565.3 Gene:madf-4 / 179386 WormBaseID:WBGene00011575 Length:329 Species:Caenorhabditis elegans


Alignment Length:233 Identity:48/233 - (20%)
Similarity:100/233 - (42%) Gaps:40/233 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DEDFNIRFVNLVRTHKCLYDKKVPEYRNRDNQEKAWVLISKET--RESVIHCKERWRNLRACLSR 116
            ::||.:..::.|:.:.|:|::..|.::..|.:.:.|.|||.|.  ....:..:.:|:::|   .:
 Worm    15 EDDFTLALIDSVQRNPCVYNRYDPLHKVTDYKHEIWKLISIEIGYDGQPVELERKWKHMR---DK 76

  Fly   117 YI------KQQSGSEPQHKPYYLTEHMAFLLPFL-----KSSRNSLEGN------NSLATLYQMS 164
            |:      ||::..:..:|.|.....|:||.|::     |..::.|..|      :..|.|..:|
 Worm    77 YVRLRKQDKQKAPIKKTNKWYNYYHKMSFLDPYVEHRNRKRQKDYLNSNTPDFLDDDTAFLDGLS 141

  Fly   165 -QQHLQHQPFLLHPALHATEEHKYCANTSINNNNNNN-------DVHNGESMEVLEMKYSISEKD 221
             ::.|:.:..|..........|...:::|..:|||..       |:.:.:....|.....::.:.
 Worm   142 VKEMLKPESLLTSNDAGYNSPHTTSSSSSSGSNNNGRFLDSPTIDIEDDKKNLALIYDKFVANQT 206

  Fly   222 DEETIDAFDP--------AVTNTL--GMNRTSSTPTRS 249
            :.|....|..        :.||||  .:..||:.|:.|
 Worm   207 ENEKNHRFSNKHGKDLLFSTTNTLIEKLATTSTAPSSS 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brwlNP_609298.1 MADF 60..145 CDD:214738 21/97 (22%)
BESS 356..389 CDD:281011
madf-4NP_505565.3 MADF 22..111 CDD:214738 21/91 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.