DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brwl and madf-2

DIOPT Version :9

Sequence 1:NP_609298.1 Gene:brwl / 34275 FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_492896.1 Gene:madf-2 / 173019 WormBaseID:WBGene00009461 Length:290 Species:Caenorhabditis elegans


Alignment Length:287 Identity:52/287 - (18%)
Similarity:95/287 - (33%) Gaps:86/287 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VNLVRTHKCLYDKKV---PEYRN---------RDNQEKAWVLISKETRESVIHCKERWRNLRACL 114
            :|.:|....::||..   ..||.         .......:.:..|.|.|.|   :.:|:||:...
 Worm    13 INAIRNRPVIWDKNYFGESNYRTLKTSCLREVTSELNSMFQMPIKFTCEDV---RSQWKNLKDTF 74

  Fly   115 SRYIK--------QQSGSEPQHKPYYLTEHMAFLLPFLKSSRNSLEGNNSLATLYQMS------- 164
            .|.::        :.:..||..|.|.       :|.||........|:....| |:::       
 Worm    75 VRKLRWVHEGKYMEDAMKEPTWKFYR-------MLTFLDEKEAKRLGDTCEHT-YELAPNSTSCG 131

  Fly   165 -QQHLQHQPFLLHPALHATEEHKYCANTSINNNNNNNDVHNGESMEVLEMKYSISEKDDEETIDA 228
             :..:.::|       .:|||..:             .:.|.:....|         ..:..||:
 Worm   132 QRAQISYEP-------TSTEEKMF-------------QMFNNQPPPQL---------SQQSMIDS 167

  Fly   229 FDPAV-TNTLGMNRTSSTPTRSSALQGGGGNSPARSDTASADSMKNFIPDV------------QL 280
            ...|. :|...|..:|:..|.|::|:.|...||.||...|:..::..:.|.            |:
 Worm   168 SQIATCSNEPKMTSSSTFVTSSTSLKRGVHYSPTRSPNGSSSGLEEELEDEDEQPGRKKSCRRQV 232

  Fly   281 AETGSQLIYSDGGHGTPPPLHYHPHSH 307
            :......:.:     |||..|.....|
 Worm   233 SNIQPMQVIT-----TPPVAHQDEFDH 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brwlNP_609298.1 MADF 60..145 CDD:214738 20/102 (20%)
BESS 356..389 CDD:281011
madf-2NP_492896.1 MADF 11..107 CDD:214738 21/103 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156202
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.