DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brwl and LOC100330838

DIOPT Version :9

Sequence 1:NP_609298.1 Gene:brwl / 34275 FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001373242.1 Gene:LOC100330838 / 100330838 -ID:- Length:204 Species:Danio rerio


Alignment Length:334 Identity:62/334 - (18%)
Similarity:105/334 - (31%) Gaps:149/334 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RFVNLVRTHKCLYDKKVPEYRNRDNQEKAWVLISKETRESVIHCKERWRNLRACLSRYIK----- 119
            |.:..|..:..||:..:..|::...:.|||..:|.:.......|:.||::||   ..:||     
Zfish     8 RLIAAVSDYPELYNSTINSYKDAARKAKAWRAVSLQVEIPEEDCRRRWKSLR---DMFIKDKRAE 69

  Fly   120 -QQSGSEPQHKPYYLTEHMAFLLPFLKSSRNSLEGNNSLATLYQMSQQHLQHQPFLLHPALHATE 183
             ::..|...|:.:..:..|:||.||::|        .|||.          .:|          |
Zfish    70 QRRRASGTSHRSWKYSWQMSFLTPFIQS--------RSLAA----------DEP----------E 106

  Fly   184 EHKYCANTSINNNNNNNDVHNGESMEVLEMKYSISEKDDEETIDAFDPAVTNTLGMNRTSSTPTR 248
            |             :.:|                .:||:|.|.|                     
Zfish   107 E-------------DRDD----------------EDKDEERTAD--------------------- 121

  Fly   249 SSALQGGGGNSPARSDTASADSMKNFIPDVQLAETGSQLIYSDGGHGTPPPLHYHPHSHPHPLTL 313
                    ||        ||..:::|                :|.||               :..
Zfish   122 --------GN--------SAFVVQDF----------------EGDHG---------------MLD 139

  Fly   314 SMDHHPASYEPGSTKRIKTECEATSTMTNAGSIYGGLSSSEVADMEFFRSILPDLATLTPQQRRK 378
            ...|:.||...||.::.|...||               :.::.|..|..|:||.|..|...::..
Zfish   140 GASHYSASGSQGSGRKRKWHMEA---------------NEDLEDEMFLFSLLPYLRRLPYAKKSA 189

  Fly   379 FKIGILELI 387
            .|:.|.:|:
Zfish   190 VKLKIHQLL 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brwlNP_609298.1 MADF 60..145 CDD:214738 23/90 (26%)
BESS 356..389 CDD:281011 10/32 (31%)
LOC100330838NP_001373242.1 MADF 8..96 CDD:214738 23/90 (26%)
BESS 167..200 CDD:397204 10/32 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.