powered by:
Protein Alignment Cpr30B and CG34462
DIOPT Version :9
Sequence 1: | NP_609295.1 |
Gene: | Cpr30B / 34270 |
FlyBaseID: | FBgn0032125 |
Length: | 153 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097548.1 |
Gene: | CG34462 / 5740319 |
FlyBaseID: | FBgn0085491 |
Length: | 312 |
Species: | Drosophila melanogaster |
Alignment Length: | 67 |
Identity: | 22/67 - (32%) |
Similarity: | 36/67 - (53%) |
Gaps: | 2/67 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 EPDYGPVAYEFQWSVNDPHTGDIKSQKESR-KDDKVEGVYELIDSDGYRRIVQYKADDHNGFEAI 88
|| |||..|.|.:.:|||.|.:.:.::|.| .:..::|.|.....||...:.:|.|.:..|:.|.
Fly 55 EP-YGPNTYSFGYEINDPQTQNSQFREEKRFVNGSIQGSYGYARPDGRIEVTKYMAKEDGGYSAQ 118
Fly 89 VQ 90
:|
Fly 119 IQ 120
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12236 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.