DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30B and LOC5667258

DIOPT Version :10

Sequence 1:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_001688119.1 Gene:LOC5667258 / 5667258 VectorBaseID:AGAMI1_002128 Length:122 Species:Anopheles gambiae


Alignment Length:91 Identity:43/91 - (47%)
Similarity:57/91 - (62%) Gaps:4/91 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MGKVTYLLCLCLASAVWAIELQAEPDY-GPVAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYEL 65
            |.|:|......||.||.|.|   ..|| ...:|:|::.|.||||||.|||.|.|..|.|:|.|.|
Mosquito     1 MMKITIAALALLAVAVAAYE---HEDYHSHPSYKFEYGVKDPHTGDHKSQWEHRDGDVVKGQYTL 62

  Fly    66 IDSDGYRRIVQYKADDHNGFEAIVQR 91
            .::||.:|:|:|.:|.||||:|.|:|
Mosquito    63 DEADGTKRVVEYSSDKHNGFQAHVKR 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:459790 27/51 (53%)
LOC5667258XP_001688119.1 Chitin_bind_4 30..82 CDD:459790 27/51 (53%)

Return to query results.
Submit another query.