DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30B and LOC4578367

DIOPT Version :10

Sequence 1:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_001238133.1 Gene:LOC4578367 / 4578367 VectorBaseID:AGAMI1_005911 Length:187 Species:Anopheles gambiae


Alignment Length:119 Identity:56/119 - (47%)
Similarity:74/119 - (62%) Gaps:15/119 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFEAIVQREPTDIK 97
            |:|.:.|:|.||||||.|:|||..|:|.|.|.||||||::|.|:|.|||||||.|:|.|||||||
Mosquito    74 YDFSYGVHDDHTGDIKEQRESRHGDQVHGQYSLIDSDGHKRTVEYTADDHNGFNAVVHREPTDIK 138

  Fly    98 IPLPEPPK--------KLLA--AKILTPVLPVAPLVHYAAPKAIIKQELSAGNY 141
            ||.|...|        |::|  |||:     .|...:|:.|...:.:.:...:|
Mosquito   139 IPQPIVQKVIAQPAIAKVIAQPAKII-----AAQPAYYSQPAPAVVKTVGLSHY 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:459790 32/51 (63%)
LOC4578367XP_001238133.1 Chitin_bind_4 74..126 CDD:459790 32/51 (63%)

Return to query results.
Submit another query.