DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30B and Ccp84Aa

DIOPT Version :10

Sequence 1:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster


Alignment Length:148 Identity:59/148 - (39%)
Similarity:76/148 - (51%) Gaps:19/148 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IELQAEPDYGP-VAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHN 83
            :.::|..:|.| ..|.|.:.|:|..|||.|.|.|.|..|.|.|.|.|||:|||:|||||.||..|
  Fly    48 VVVKAAEEYDPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPIN 112

  Fly    84 GFEAIVQREPTDIKIPLPEPPKKLLAAKILTPVLP-------------VAPLVHYAAPKAIIKQE 135
            ||.|:|.|||. :|.....|..|.:||.:.....|             |||:.||||| |::|..
  Fly   113 GFNAVVNREPL-VKAVAVAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAP-AVVKTV 175

  Fly   136 LSAGNYVSVSGPTAQYKY 153
            ....:|   :.|.|...|
  Fly   176 APVAHY---AAPAAYATY 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:459790 29/51 (57%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:459790 29/51 (57%)

Return to query results.
Submit another query.