DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30B and Ccp84Ab

DIOPT Version :9

Sequence 1:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster


Alignment Length:148 Identity:58/148 - (39%)
Similarity:75/148 - (50%) Gaps:19/148 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IELQAEPDYGP-VAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHN 83
            :.::|..:|.| ..|.|.:.|:|..|||.|.|.|.|..|.|.|.|.|||:|||:|.|||.||..|
  Fly    48 VVVKAAEEYDPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPIN 112

  Fly    84 GFEAIVQREPTDIKIPLPEPPKKLLAAKILTPVLP-------------VAPLVHYAAPKAIIKQE 135
            ||.|:|.|||. :|.....|..|.:||.:.....|             |||:.||||| |::|..
  Fly   113 GFNAVVNREPL-VKAVAVAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAP-AVVKTV 175

  Fly   136 LSAGNYVSVSGPTAQYKY 153
            ....:|   :.|.|...|
  Fly   176 APVAHY---AAPAAYATY 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 28/51 (55%)
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:278791 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453218
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.