DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30B and Ccp84Ad

DIOPT Version :10

Sequence 1:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster


Alignment Length:151 Identity:57/151 - (37%)
Similarity:75/151 - (49%) Gaps:22/151 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QAEPDYGP-VAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFE 86
            :|..:|.| ..|::.:.|.|..:||.|||.|.|..|.|.|.|.|||:|||:|.|||.||..|||.
  Fly    51 KAAEEYDPHPQYKYAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFN 115

  Fly    87 AIVQREPTDIKIPLPEPPKKLLAAKILTPVLP-------------VAPLVHYAAPKAIIK----- 133
            |:|.|||. :|.....|..|.:||.:.....|             |||:.||||| |::|     
  Fly   116 AVVNREPL-VKAVAVAPVVKTVAAPVAHYAAPAVAHYAAPAVVKTVAPVAHYAAP-AVVKTVAPV 178

  Fly   134 -QELSAGNYVSVSGPTAQYKY 153
             ...:...|.|.:.|...|.:
  Fly   179 AHYAAPATYTSYAAPAVAYHH 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:459790 27/51 (53%)
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 27/51 (53%)

Return to query results.
Submit another query.