DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30B and Edg84A

DIOPT Version :10

Sequence 1:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster


Alignment Length:130 Identity:54/130 - (41%)
Similarity:69/130 - (53%) Gaps:20/130 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFEAIVQREPTDI- 96
            |.|.:.|.||.|||:|||.|||..|.|.|.|.:.|:|||||.|.|.|||..||.|:|:|||... 
  Fly    37 YSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGFNAVVRREPLSSA 101

  Fly    97 -------------KIPLPEPPKKLLAAKILTPVLPV-----APLVHYAAPKAIIKQELSAGNYVS 143
                         |:.| :|.|||.|.|.|:....|     ||:||:|....::.....|.::||
  Fly   102 AVVVKPQATAVVPKVQL-KPLKKLPALKPLSQASAVVHRSFAPVVHHAPVTHVVHHAAPAHSFVS 165

  Fly   144  143
              Fly   166  165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:459790 29/51 (57%)
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:459790 29/51 (57%)

Return to query results.
Submit another query.