DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30B and Cpr78Cc

DIOPT Version :10

Sequence 1:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster


Alignment Length:106 Identity:26/106 - (24%)
Similarity:43/106 - (40%) Gaps:14/106 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YLLCLCLASAVWAIELQAE----------PDYGPVAYEFQWSVNDPHTGDIKSQKESRKDDKVEG 61
            :.|.|||.:|:....:.|:          .|..|...|..:......:..|::| |:...:.:.|
  Fly     2 FKLSLCLLAALMLANVYADNINKDAVITREDVNPADAEGNYQYAFETSNGIQAQ-EAGNVNGISG 65

  Fly    62 VYELIDSDGYRRIVQYKADDHNGFEAIVQREPTDIKIPLPE 102
            ....|..:|....:.|.||: |||:......||  ..|:||
  Fly    66 SSSYISPEGVPISLTYVADE-NGFQPQGDHLPT--APPIPE 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:459790 11/51 (22%)
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:459790 10/47 (21%)

Return to query results.
Submit another query.