DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30B and Cpr76Ba

DIOPT Version :10

Sequence 1:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster


Alignment Length:66 Identity:35/66 - (53%)
Similarity:45/66 - (68%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EPDYGPVAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFEAIV 89
            ||.:.| .|||.:.|.|..|||||.|.|:|..|||:|.|.:.::||..|||:|.||.||||:|.|
  Fly    93 EPKHHP-KYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQATV 156

  Fly    90 Q 90
            :
  Fly   157 K 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:459790 28/51 (55%)
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:459790 28/51 (55%)

Return to query results.
Submit another query.