DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30B and Cpr67B

DIOPT Version :9

Sequence 1:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_648306.1 Gene:Cpr67B / 39081 FlyBaseID:FBgn0035985 Length:260 Species:Drosophila melanogaster


Alignment Length:93 Identity:23/93 - (24%)
Similarity:37/93 - (39%) Gaps:13/93 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AIELQAEPDYGPVAYEFQWSVNDPHTGDIKSQKESRKDD--KVEGVYELIDSDGYRRIVQYKADD 81
            |.:...:...|..||.::         |....|..::|:  ||.|.|:.:...|...:..|.| |
  Fly    86 AHQYHGQDGLGQFAYGYR---------DWNQGKNEKRDETGKVTGSYKYVQPHGRDFVANYYA-D 140

  Fly    82 HNGFEAIVQREPTDIKIPLPEPPKKLLA 109
            ..||. :....|..:|:|..:.|..|.|
  Fly   141 KTGFH-VEDNRPAHLKLPATKTPAVLKA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 12/53 (23%)
Cpr67BNP_648306.1 Chitin_bind_4 <111..144 CDD:278791 9/33 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453279
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.