DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30B and Cpr65Eb

DIOPT Version :10

Sequence 1:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster


Alignment Length:121 Identity:31/121 - (25%)
Similarity:54/121 - (44%) Gaps:24/121 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MGKVTYLLCLCLASAVWAIELQAEPDYGPVAY-EFQWSVND--PHTGDIKSQKE-----SRKDDK 58
            |.|:..::.:.::.   .:.:||.|...|.|: |.:..||:  ...|....|.|     ::::..
  Fly     1 MSKINVVVLVAMSV---LLGVQARPSDSPDAHAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQG 62

  Fly    59 VEGVYELIDSDGYR---RIVQ--YKADDHNGFEAIVQREPTDIKIPLPEP-PKKLL 108
            |.|.|....|..|.   :::|  |.||: |||      :|....:|.|.| |:.:|
  Fly    63 VGGYYASGSSQYYTPEGQLIQLTYTADE-NGF------QPQGEHLPTPHPIPEAIL 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:459790 16/64 (25%)
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:459790 12/47 (26%)

Return to query results.
Submit another query.