DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30B and Cpr64Ab

DIOPT Version :10

Sequence 1:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster


Alignment Length:123 Identity:47/123 - (38%)
Similarity:64/123 - (52%) Gaps:17/123 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KVTYLLCLCLASAVWA---------IELQAEPDYGPVAYEFQWSVNDPHTGDIKSQKESRKDDKV 59
            |:|.:.|..:|:...|         :.|..|.|..| .|.|.::|.|..|||.|||:|.|..|.|
  Fly     5 KITLICCALIAAIECALLPAAVPVGVPLNTEVDPHP-QYAFAYNVQDALTGDSKSQQEVRDGDVV 68

  Fly    60 EGVYELIDSDGYRRIVQYKADDHNGFEAIVQREPTDIKIPLPEPPKKLLAAKILTPVL 117
            :|.|.::|:||..|.|.|.||..|||.|:|||.|    :|:...|   |.|.:..|:|
  Fly    69 KGSYSVVDADGSLRTVFYTADPINGFNAVVQRGP----VPVAARP---LVAPVAAPIL 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:459790 25/51 (49%)
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:459790 25/51 (49%)

Return to query results.
Submit another query.