DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30B and Cpr64Aa

DIOPT Version :9

Sequence 1:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster


Alignment Length:168 Identity:57/168 - (33%)
Similarity:86/168 - (51%) Gaps:39/168 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LCLASAVW----AIELQAEPDY---------------GPVAYE------FQWSVNDPHTGDIKSQ 50
            :.::|||.    .:.|.|.|.|               ||..|:      |.:.|:|..|||:|||
  Fly    13 VAVSSAVVVPGPGLALPAYPSYPALAKVAAPLVAKVAGPEPYDPNPQYTFSYDVHDGSTGDVKSQ 77

  Fly    51 KESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFEAIVQREPTDIKIPLPEPPKKLLAAKILTP 115
            :|:|..|.|:|.|.||::||.||||:|.||..:||.|:|:||...:|...|       .||:|.|
  Fly    78 QETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRREGAVVKAVAP-------VAKVLAP 135

  Fly   116 VLPVAPLVHYAAPKAIIKQELSAGNYVSVSGPTAQYKY 153
                |||:| |:|  ::.:..:.|..::.:.|...:.|
  Fly   136 ----APLLH-ASP--LVAKVPAYGPALAPAYPALAHGY 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 27/57 (47%)
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:278791 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.