DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30B and Cpr64Aa

DIOPT Version :10

Sequence 1:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster


Alignment Length:168 Identity:57/168 - (33%)
Similarity:86/168 - (51%) Gaps:39/168 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LCLASAVW----AIELQAEPDY---------------GPVAYE------FQWSVNDPHTGDIKSQ 50
            :.::|||.    .:.|.|.|.|               ||..|:      |.:.|:|..|||:|||
  Fly    13 VAVSSAVVVPGPGLALPAYPSYPALAKVAAPLVAKVAGPEPYDPNPQYTFSYDVHDGSTGDVKSQ 77

  Fly    51 KESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFEAIVQREPTDIKIPLPEPPKKLLAAKILTP 115
            :|:|..|.|:|.|.||::||.||||:|.||..:||.|:|:||...:|...|       .||:|.|
  Fly    78 QETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRREGAVVKAVAP-------VAKVLAP 135

  Fly   116 VLPVAPLVHYAAPKAIIKQELSAGNYVSVSGPTAQYKY 153
                |||:| |:|  ::.:..:.|..::.:.|...:.|
  Fly   136 ----APLLH-ASP--LVAKVPAYGPALAPAYPALAHGY 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:459790 27/57 (47%)
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:459790 26/51 (51%)

Return to query results.
Submit another query.