DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30B and Cpr56F

DIOPT Version :10

Sequence 1:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster


Alignment Length:68 Identity:26/68 - (38%)
Similarity:39/68 - (57%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EPDYGPVAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFEAIV 89
            |..|||..|||::.|.|..:|:.....|||..|...|.|.::..||.::||:|:| |.||:...:
  Fly   120 EEQYGPAKYEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEYEA-DQNGYRPTI 183

  Fly    90 QRE 92
            :.|
  Fly   184 RYE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:459790 20/51 (39%)
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:459790 20/51 (39%)

Return to query results.
Submit another query.