DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30B and Cpr47Eg

DIOPT Version :10

Sequence 1:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster


Alignment Length:100 Identity:30/100 - (30%)
Similarity:41/100 - (41%) Gaps:15/100 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLCLCLASA---VWAIELQAEPDYGPVAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSD 69
            ||.:.||:.   |...|.|...|....|.|...|||....||:..:     :..|:|.......:
  Fly    10 LLAVALANEDANVLRAEQQVNVDGFAYAVELDNSVNVQQKGDLNGE-----EWVVKGSQSWTSPE 69

  Fly    70 GYRRIVQYKADDHNGFEAIVQREPTDIKIPLPEPP 104
            .....:||.| |.||:: :|...|     |||.||
  Fly    70 NVPVSIQYIA-DANGYQ-VVSANP-----PLPTPP 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:459790 13/51 (25%)
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:459790 14/55 (25%)

Return to query results.
Submit another query.