DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30B and Cpr23B

DIOPT Version :9

Sequence 1:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster


Alignment Length:104 Identity:42/104 - (40%)
Similarity:55/104 - (52%) Gaps:14/104 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EPD-YGPVAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFEAI 88
            ||: :.|.:|.|.::|||..|||||...|:|....|.|.|.|||.|||:|.|.|.|||.:||.|:
  Fly   148 EPEVFPPASYSFNYAVNDASTGDIKEHSETRDGYVVRGFYSLIDPDGYKRTVTYTADDVHGFNAV 212

  Fly    89 VQREPTDIKIPLPEPPKKLLAAKILTPVLPVAPLVHYAA 127
            |.|.|..:|             .::.||..||....:.|
  Fly   213 VNRVPYALK-------------AVVVPVAQVAQPTPFVA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 27/51 (53%)
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:278791 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.