DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30B and Cpr30F

DIOPT Version :9

Sequence 1:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster


Alignment Length:123 Identity:58/123 - (47%)
Similarity:77/123 - (62%) Gaps:15/123 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IELQAEPDYGPVAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHNG 84
            :|::|     |..|:|.:||:|.||||||||.||||.|:|:|.|.|:|:|||.|.|.|.:|.|||
  Fly    37 VEVEA-----PAHYDFAYSVHDEHTGDIKSQTESRKGDQVQGQYTLVDADGYLRTVDYTSDAHNG 96

  Fly    85 FEAIVQREPTDIKIPLPEPPKKLLAAKILTPV-LPVAPLVHYAAPKAIIKQELSAGNY 141
            |.|:|:|:|...|:....|     .||:|.|. ||:|    |||||.:...:|..|.|
  Fly    97 FNAVVRRDPLGQKVIKAAP-----IAKLLAPAPLPLA----YAAPKLLAPAKLPLGLY 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 32/51 (63%)
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:395303 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466428
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593516at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.