DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17855 and RUD3

DIOPT Version :9

Sequence 1:NP_609294.1 Gene:CG17855 / 34269 FlyBaseID:FBgn0032124 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_014859.3 Gene:RUD3 / 854391 SGDID:S000005742 Length:484 Species:Saccharomyces cerevisiae


Alignment Length:332 Identity:73/332 - (21%)
Similarity:122/332 - (36%) Gaps:82/332 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LYAELAAAKSRSAELEEENILLRHRLNRASASHSTNAAINVEAKIMVFQLEEERDRLVETLQKHK 76
            |..:|.|.|:.::||:...:.|...|........:...:.:|.:..:..||:|:..::|...|..
Yeast   179 LKKKLEATKTENSELQSTIVTLNTELENLEKEQESTEEVFLEYESRIEALEDEKHDIIEKHSKEL 243

  Fly    77 KKYNKLHDAYLEKVKRCRALEEMFKRQKTLTGLVMKSSLDQRNAEQRMAMEKRQSAQSDV-NELN 140
            ..|.|..|....:|:....:.|..|:.        .|.|.....|.|.|:|..:..::.: |.||
Yeast   244 NTYRKEKDQLNLQVQELMIILENNKQD--------ISDLRTERDELRQALESHEKEKAVLKNSLN 300

  Fly   141 ELKAKVEKLQRALDES--------YDIIDEMDFELES----VELLEMQNQSLRDELAAFKAKSEE 193
            :|:.|:|::....:|.        ..:..::|.|:|:    .|.||    |::.:|.|.|     
Yeast   301 DLELKIEEVDNKREEEARERDQEVKSLRSQLDTEIETHNNDTEALE----SMKKQLEAMK----- 356

  Fly   194 GATSLPASLPNDDDPPPKYEEDYPGQH----------------H--KAMQARRCSSSSESDPKD- 239
                      .|.....||||: ..||                |  ||:...:.||.|||..|: 
Yeast   357 ----------EDASMKEKYEEE-SKQHILQIGKLRHEAIILNEHLTKALAMLKKSSDSESVDKEL 410

  Fly   240 -----------DDADAETMERAALTHSLIQTVETE--------SNALRRELLRSRCQRTIRA--- 282
                       ..||....|...|..:.:...|.:        :|..:.....||.:..:..   
Yeast   411 ISNLLISFVSIPRADPRKFEVLELLSNFLNWDEDKKQQAGLISNNESKNSSAVSRTESFVSLWTN 475

  Fly   283 KLEKESE 289
            .||||||
Yeast   476 YLEKESE 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17855NP_609294.1 Smc <14..>291 CDD:224117 72/330 (22%)
RUD3NP_014859.3 SMC_prok_A 88..>382 CDD:274009 50/230 (22%)
GRAB 401..449 CDD:402134 10/47 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.