DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17855 and CTTNBP2NL

DIOPT Version :9

Sequence 1:NP_609294.1 Gene:CG17855 / 34269 FlyBaseID:FBgn0032124 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_061174.1 Gene:CTTNBP2NL / 55917 HGNCID:25330 Length:639 Species:Homo sapiens


Alignment Length:230 Identity:59/230 - (25%)
Similarity:107/230 - (46%) Gaps:46/230 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KRATSTMQVLYAELAAAKSRS----AELEEENILLRHRLNRASASHSTNAAINVEAKIMVFQLEE 63
            |:..:..:.:.::||||:||.    .:||||    |.|       |:.:.|   |...:.:.||:
Human    88 KQCKNMQERMLSQLAAAESRHRKVILDLEEE----RQR-------HAQDTA---EGDDVTYMLEK 138

  Fly    64 ERDRLVETLQKHK---KKYNKLHDAYLEKVKRCRALEEMFKRQKTLTGLVMKSSLDQRNAEQRMA 125
            ||:||.:.|:..|   ||:.|      |:.|....|||...|.|.|:.:::   |:.:.|..:.|
Human   139 ERERLTQQLEFEKSQVKKFEK------EQKKLSSQLEEERSRHKQLSSMLV---LECKKATNKAA 194

  Fly   126 MEKRQSAQSDVNELNELKAKVEKLQ--------RALDESYDI---IDEMDFELESVELL----EM 175
            .|.:::.:..: :|.:.|::|.||:        |.|.....:   :.|.|.|.|.:...    |.
Human   195 EEGQKAGELSL-KLEKEKSRVSKLEEELAAERKRGLQTEAQVEKQLSEFDIEREQLRAKLNREEN 258

  Fly   176 QNQSLRDELAAFKAKSEEGATSLPASLPNDDDPPP 210
            :.::|::|:.:.|...::...|...|.||:....|
Human   259 RTKTLKEEMESLKKIVKDLEASHQHSSPNEQLKKP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17855NP_609294.1 Smc <14..>291 CDD:224117 58/219 (26%)
CTTNBP2NLNP_061174.1 CortBP2 5..188 CDD:286770 36/122 (30%)
RILP-like <96..246 CDD:304877 47/173 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..430
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 463..490
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 511..609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.