DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment numb and Fam43b

DIOPT Version :9

Sequence 1:NP_001260291.1 Gene:numb / 34263 FlyBaseID:FBgn0002973 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001075141.1 Gene:Fam43b / 625638 MGIID:3651622 Length:330 Species:Mus musculus


Alignment Length:218 Identity:48/218 - (22%)
Similarity:84/218 - (38%) Gaps:53/218 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 MDRLRRSFRDSFRRRKDRVPESSKPHQWQADEEAVRSATCSFSVKYLGCVEVFESRGMQVCEEAL 106
            ::||.|.||.  ||:|..:.:...                :::|.|||......::|....::|:
Mouse    49 LERLGRVFRS--RRQKVELNKEDP----------------TYTVWYLGNAVTLHAKGDGCTDDAV 95

  Fly   107 KVLRQSRRRPVRGL---LHVSGDGLRVVDDE-TKGLIVDQ------TIEKVSFCAPDRNHERGFS 161
            ..: .:|..|..|.   |.:...|:|:...| :.|....:      .:.::::||.|..|.|.|:
Mouse    96 GRI-WARCGPGGGTKMKLTLGPHGIRMQPSERSSGASGGRRPAHAYLLPRITYCAADGRHPRVFT 159

  Fly   162 YICRDGTTRRWM---CHGFLACK----DSGERLSHAVGCAFAVCLERKQRRDKECGVTMTFDTKN 219
            ::.|.....:.:   ||..|..:    .|..||.|....|.....:|.||:.         |.::
Mouse   160 WVYRHQARHKAVVLRCHAVLLARAHKARSLARLLHQTALAAFSDFKRLQRQS---------DARH 215

  Fly   220 STFTRTGSFRQQTLTERLAMATV 242
                    .|||.|....|.|:|
Mouse   216 --------VRQQHLRAGGAAASV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
numbNP_001260291.1 PTB_Numb 67..201 CDD:241298 29/150 (19%)
NumbF 269..374 CDD:283874
Fam43bNP_001075141.1 PID_2 71..263 CDD:258856 40/178 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831098
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.