DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment numb and ldlrap1

DIOPT Version :9

Sequence 1:NP_001260291.1 Gene:numb / 34263 FlyBaseID:FBgn0002973 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001017114.1 Gene:ldlrap1 / 549868 XenbaseID:XB-GENE-954261 Length:309 Species:Xenopus tropicalis


Alignment Length:189 Identity:49/189 - (25%)
Similarity:83/189 - (43%) Gaps:29/189 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 MDRLRRSFRDSFRRRKDRVPESSK-----------PHQWQADEEAVRSATCSFSVKYLGCVEVFE 95
            ||.|:.:.|...|.     |..:|           |..|....|.:... .||.:||||...|.:
 Frog     1 MDALKSAGRAIIRS-----PSIAKQSWGGGKHKKLPENWTDTRETLLEG-MSFHLKYLGMTLVEQ 59

  Fly    96 SRGMQVCEEALK----VLRQSRRRPVRGLLHVSGDGLRVVDDETKGLIVDQTIEKVSFCAPDRNH 156
            .:|.::...|:|    ..:.|.::..:.:|.||..|:.:.|..:..||.:.:|.::|:|..|:.|
 Frog    60 PKGEELSATAVKRIVATAKASGKKLQKVILKVSPRGIILYDLASNQLIENVSIYRISYCTADKMH 124

  Fly   157 ERGFSYICRDGTTRRWMCHGFLACK-DSGERLSHAVGCAFAVCL-------ERKQRRDK 207
            ::.|:||.:........||.||..| ...:.::..|..||.|..       |.|::|:|
 Frog   125 DKVFAYIAQSQQNETLECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSRENKEKREK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
numbNP_001260291.1 PTB_Numb 67..201 CDD:241298 37/145 (26%)
NumbF 269..374 CDD:283874
ldlrap1NP_001017114.1 PTB_LDLRAP-mammal-like 43..165 CDD:269981 33/122 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.