DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment numb and Aplip1

DIOPT Version :9

Sequence 1:NP_001260291.1 Gene:numb / 34263 FlyBaseID:FBgn0002973 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_728573.1 Gene:Aplip1 / 53472 FlyBaseID:FBgn0040281 Length:490 Species:Drosophila melanogaster


Alignment Length:121 Identity:38/121 - (31%)
Similarity:57/121 - (47%) Gaps:13/121 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 YLGCVEVFESRGM-QVCEEALKVLRQSRRRPV--RGLLHVSGDGLRVVD-------DETKGLIVD 141
            |||.||....:|. .||:...|::.:....|.  ..:|.||..|||:||       .:.|...:|
  Fly   351 YLGSVETLAHKGTGVVCQAVRKIVGEYGNSPTGQTCILEVSDQGLRMVDRSGPNQNKKDKKPCID 415

  Fly   142 --QTIEKVSFCAPDRNHERGFSYICRDGTTRRWMCHGFLACKDSGERLSHAVGCAF 195
              .:::.|||||......|...:|.:..|.:|:.||.|.. .:|...::.|||.||
  Fly   416 YFYSLKNVSFCAFHPRDHRFIGFITKHPTVQRFACHVFKG-SESTRPVAEAVGRAF 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
numbNP_001260291.1 PTB_Numb 67..201 CDD:241298 38/121 (31%)
NumbF 269..374 CDD:283874
Aplip1NP_728573.1 SH3_JIP1_like 275..329 CDD:212735
PTB_JIP 343..490 CDD:269923 38/121 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438621
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11232
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.