DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment numb and Ldlrap1

DIOPT Version :9

Sequence 1:NP_001260291.1 Gene:numb / 34263 FlyBaseID:FBgn0002973 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001102741.1 Gene:Ldlrap1 / 500564 RGDID:1563417 Length:307 Species:Rattus norvegicus


Alignment Length:244 Identity:64/244 - (26%)
Similarity:101/244 - (41%) Gaps:46/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 MDRLRRSFRDSFRRRKDRVPESSK-----------PHQWQADEEAVRSATCSFSVKYLGCVEVFE 95
            ||.|:     |..|...|.|..:|           |..|....|.:..... ||:||||...|..
  Rat     1 MDALK-----SAGRALIRSPSLAKQSWAGGRHRKLPENWTDTRETLLEGMV-FSLKYLGMTLVER 59

  Fly    96 SRGMQVCEEALK----VLRQSRRRPVRGLLHVSGDGLRVVDDETKGLIVDQTIEKVSFCAPDRNH 156
            .:|.::...|:|    ..:.|.::..:..|.||..|:.:.|..|..||.:.:|.::|:|..|:.|
  Rat    60 PKGEELSAAAVKRIVATAKASGKKLQKVTLKVSPRGIILTDSLTSQLIENVSIYRISYCTADKMH 124

  Fly   157 ERGFSYICRDGTTRRWMCHGFLACKDS-GERLSHAVGCAFAVCL-------ERKQRRDK---ECG 210
            ::.|:||.:........||.||..|.. .:.::..|..||.|..       |.|::|:|   |.|
  Rat   125 DKVFAYIAQSQQNESLECHAFLCTKRKVAQAVTLTVAQAFKVAFEFWQVSKEEKEKREKANQEGG 189

  Fly   211 VTMTFDTKNSTFTRTGSFRQQTLT------ERLA---MATVGTNERSVD 250
                 |...:....|.|.:....|      |.||   ::||..|.:::|
  Rat   190 -----DVPGTRRDSTPSLKTSVATGNLLDLEELAKAPLSTVSANTKNMD 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
numbNP_001260291.1 PTB_Numb 67..201 CDD:241298 38/145 (26%)
NumbF 269..374 CDD:283874
Ldlrap1NP_001102741.1 PTB_LDLRAP-mammal-like 43..165 CDD:269981 34/122 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..205 7/30 (23%)
Clathrin box. /evidence=ECO:0000250|UniProtKB:Q5SW96 211..215 0/3 (0%)
AP-2 complex binding. /evidence=ECO:0000250|UniProtKB:Q5SW96 248..275
[DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif. /evidence=ECO:0000250|UniProtKB:Q5SW96 256..265
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334824
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.