DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment numb and ldlrap1a

DIOPT Version :9

Sequence 1:NP_001260291.1 Gene:numb / 34263 FlyBaseID:FBgn0002973 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_945331.1 Gene:ldlrap1a / 368278 ZFINID:ZDB-GENE-030328-13 Length:287 Species:Danio rerio


Alignment Length:232 Identity:55/232 - (23%)
Similarity:101/232 - (43%) Gaps:28/232 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 MDRLRRSFRDSFRRRKDRVPESSK-----------PHQWQADEEAVRSATCSFSVKYLGCVEVFE 95
            ||.|:     |.||...|.|..:|           |..|....|.:... .:|::::||...|.:
Zfish     1 MDVLK-----SARRAFIRSPSLTKQSWSSGKHKKLPENWTDTRETLLEG-MTFNLRHLGMTLVDQ 59

  Fly    96 SRGMQVCEEALK----VLRQSRRRPVRGLLHVSGDGLRVVDDETKGLIVDQTIEKVSFCAPDRNH 156
            .:|.::...|:|    ..:.|.::..:..|.||..|:.:.|..:..||.:.:|.::|:|..|:.|
Zfish    60 PKGEELSAAAVKRIVATAKASGKKLPKVALKVSPQGIILYDSVSNQLIENISIYRISYCTADKTH 124

  Fly   157 ERGFSYICRDGTTRRWMCHGFLACKDS-GERLSHAVGCAFAVCLE-RKQRRDKECGVTMTFDTKN 219
            ::.|::|.::.......||.||..|.. .:.::..|..||.|..| .:..:|::     .:|:..
Zfish   125 DKVFAFIAQNQQNETLECHAFLCAKRKVAKAVTLTVAQAFRVAFEFWEVAKDEK-----KWDSAG 184

  Fly   220 STFTRTGSFRQQTLTERLAMATVGTNERSVDGPGSAM 256
            .|...:.|.|..:||.....|....|...::...||:
Zfish   185 ETSNSSQSDRSVSLTSLKVGAAATENLLEIEDYTSAL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
numbNP_001260291.1 PTB_Numb 67..201 CDD:241298 34/139 (24%)
NumbF 269..374 CDD:283874
ldlrap1aNP_945331.1 PTB_LDLRAP-mammal-like 43..165 CDD:269981 29/122 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574059
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.