DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment numb and fam43a

DIOPT Version :9

Sequence 1:NP_001260291.1 Gene:numb / 34263 FlyBaseID:FBgn0002973 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_999870.1 Gene:fam43a / 334166 ZFINID:ZDB-GENE-030131-6098 Length:348 Species:Danio rerio


Alignment Length:356 Identity:70/356 - (19%)
Similarity:132/356 - (37%) Gaps:97/356 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SASFRFSKKSPKK-MDRLRRSFRDSFRRRKDRVPESSKPHQWQADEEAVRSATCSFSVKYLGCVE 92
            ||...|:|..|:. ::|:...|:.  :|:|.:: .|..|               :::|.|||...
Zfish    31 SALTSFAKSCPESALNRVGSMFKS--KRKKVKI-TSEDP---------------TYTVLYLGNAT 77

  Fly    93 VFESRGMQVCEEAL-KVLRQSR--RRPVRGLLHVSGDGLRV--VDDETKGLIVDQTIEKVSFCAP 152
            ..:|:|....:.|: |:..:|.  :...:..|.:|..|:|:  ||::.|.......:.::::|..
Zfish    78 TIQSKGDGCTDVAVSKIWGKSEMGKNGTKMKLTISSQGIRMVHVDEKAKRPGHLYLLHRITYCVA 142

  Fly   153 DRNHERGFSYICRDGTTRRWM---CHGFLACKDSGER----LSHAVGCAFAVCLERKQRRDKECG 210
            |....:.|::|.|.....:.:   ||..|..|....:    |.:..........:|.:|||    
Zfish   143 DPRLPKIFAWIYRHEMKHKAVMLRCHAVLVSKPEKAKAMALLLYQTSATALAEFKRLKRRD---- 203

  Fly   211 VTMTFDTKNSTFTRTGSFRQQTLTERLAMATVGTNERSVDGPGSAMPGPPAATVKPFNPFAIERP 275
                 |.::         :||.|.....:..|...:..   .|.....||           :||.
Zfish   204 -----DARH---------QQQQLIGEQTIPLVPLRKLL---NGQCYYKPP-----------VERS 240

  Fly   276 HATPNM------------LERQSSFR----LST----IGSQSPFKRQMSLRINDLPSNADRQRAF 320
            .:.|.:            .|:...|.    |.|    :|:.   |:::...||||.|        
Zfish   241 RSAPKLGSITEDLLGEEEEEKAMHFECEDILDTDSDCVGNG---KQELCQIINDLGS-------- 294

  Fly   321 LTAAAGNPMQTPLRSVSPIAEVSPAKSAGAD 351
              ...||.:|| |::...:..:...:|.|::
Zfish   295 --MCIGNDVQT-LKADLRVTRLLSGESTGSE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
numbNP_001260291.1 PTB_Numb 67..201 CDD:241298 26/145 (18%)
NumbF 269..374 CDD:283874 21/103 (20%)
fam43aNP_999870.1 PID_2 67..252 CDD:258856 41/216 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574060
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.