DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment numb and LDLRAP1

DIOPT Version :9

Sequence 1:NP_001260291.1 Gene:numb / 34263 FlyBaseID:FBgn0002973 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_056442.2 Gene:LDLRAP1 / 26119 HGNCID:18640 Length:308 Species:Homo sapiens


Alignment Length:235 Identity:59/235 - (25%)
Similarity:100/235 - (42%) Gaps:31/235 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RRSFRDSFRRRKDRVPESSKPHQWQADEEAVRSATCSFSVKYLGCVEVFESRGMQVCEEALK--- 107
            ::|:....|.||       .|..|....|.:..... ||:||||...|.:.:|.::...|:|   
Human    19 KQSWGGGGRHRK-------LPENWTDTRETLLEGML-FSLKYLGMTLVEQPKGEELSAAAIKRIV 75

  Fly   108 -VLRQSRRRPVRGLLHVSGDGLRVVDDETKGLIVDQTIEKVSFCAPDRNHERGFSYICRDGTTRR 171
             ..:.|.::..:..|.||..|:.:.|:.|..||.:.:|.::|:|..|:.|::.|:||.:....:.
Human    76 ATAKASGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYRISYCTADKMHDKVFAYIAQSQHNQS 140

  Fly   172 WMCHGFLACK-DSGERLSHAVGCAFAVCL-------ERKQRRDKE-------CGVTMTFDTKNST 221
            ..||.||..| ...:.::..|..||.|..       |.|::|||.       .|..........:
Human   141 LECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPSLKS 205

  Fly   222 FTRTGSFRQQTLTERLAMATVGTNERSVDGPGSAMPGPPA 261
            ...||:......|.:..::||..|..::|    .:|.|.|
Human   206 LVATGNLLDLEETAKAPLSTVSANTTNMD----EVPRPQA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
numbNP_001260291.1 PTB_Numb 67..201 CDD:241298 38/145 (26%)
NumbF 269..374 CDD:283874
LDLRAP1NP_056442.2 PTB_LDLRAP-mammal-like 44..166 CDD:269981 34/122 (28%)
Clathrin box. /evidence=ECO:0000269|PubMed:12221107 212..216 0/3 (0%)
AP-2 complex binding. /evidence=ECO:0000269|PubMed:12221107 249..276
[DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif. /evidence=ECO:0000269|PubMed:16516836 257..266
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141159
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.