DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment numb and Mapk8ip1

DIOPT Version :9

Sequence 1:NP_001260291.1 Gene:numb / 34263 FlyBaseID:FBgn0002973 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_035292.2 Gene:Mapk8ip1 / 19099 MGIID:1309464 Length:707 Species:Mus musculus


Alignment Length:242 Identity:56/242 - (23%)
Similarity:94/242 - (38%) Gaps:65/242 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GNSSSHTHEPLERGFTRGKFGDVKNGKS------ASFRFSKKSPKKMD----------------- 43
            |.|.|.:.|..      |.|..|.||:.      |.|||..:...:::                 
Mouse   463 GRSRSSSAESF------GLFSCVINGEEHEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYW 521

  Fly    44 ----RLRRSFRDSF--------RRRKDRVPESSKPHQWQADEEAVRSATCSFSVKYLGCVEVFES 96
                .:|...|..|        .:..:.:...:|...| .|:         |.||:||.|:|...
Mouse   522 YEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDW-IDQ---------FRVKFLGSVQVPYH 576

  Fly    97 RGMQVCEEALKVLRQSRR------RPVRGLLHVSGDGLRV---VDD--ETKGLIVDQ--TIEKVS 148
            :|..|...|::.:..:||      .|...:|.:|..|:::   .||  |.||.....  .::.:|
Mouse   577 KGNDVLCAAMQKIATTRRLTVHFNPPSSCVLEISVRGVKIGVKADDALEAKGNKCSHFFQLKNIS 641

  Fly   149 FCAPDRNHERGFSYICRDGTTRRWMCHGFLACKDSGERLSHAVGCAF 195
            ||.....:.:.|.:|.:.....|:.||.|:: :||.:.|:.:||.||
Mouse   642 FCGYHPKNNKYFGFITKHPADHRFACHVFVS-EDSTKALAESVGRAF 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
numbNP_001260291.1 PTB_Numb 67..201 CDD:241298 39/142 (27%)
NumbF 269..374 CDD:283874
Mapk8ip1NP_035292.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..367
JNK-binding domain (JBD) 127..281
Minimal inhibitory domain (MID) 153..172
Interaction with MAP3K7. /evidence=ECO:0000250 279..467 2/3 (67%)
D-box 1 349..356
D-box 2 360..368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..447
Interaction with VRK2. /evidence=ECO:0000250 467..656 42/204 (21%)
SH3_JIP1 488..542 CDD:212876 7/53 (13%)
PTB_JIP 559..707 CDD:269923 39/140 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831077
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.