DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment numb and FAM43B

DIOPT Version :9

Sequence 1:NP_001260291.1 Gene:numb / 34263 FlyBaseID:FBgn0002973 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_997217.1 Gene:FAM43B / 163933 HGNCID:31791 Length:329 Species:Homo sapiens


Alignment Length:297 Identity:53/297 - (17%)
Similarity:86/297 - (28%) Gaps:127/297 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 MDRLRRSFRDSFRRRKDRVPESSKPHQWQADEEAVRSATCSFSVKYLGCVEVFESRG-------- 98
            ::||.|.||.  ||:|..:.:...                :::|.|||......::|        
Human    49 LERLGRVFRS--RRQKVELNKEDP----------------TYTVWYLGNAVTLHAKGDGCTDDAV 95

  Fly    99 -------------------------MQVCEEALKVLRQSRRRPVRGLLHVSGDGLRVVDDETKGL 138
                                     ||.||.: .......|||....|                 
Human    96 GKIWARCGPGGGTKMKLTLGPHGIRMQPCERS-AAGGSGGRRPAHAYL----------------- 142

  Fly   139 IVDQTIEKVSFCAPDRNHERGFSYICRDGTTRRWM---CHGFLACKDSGER-----LSHAVGCAF 195
                 :.::::|..|..|.|.|:::.|.....:.:   ||..|..:....|     |......||
Human   143 -----LPRITYCTADGRHPRVFAWVYRHQARHKAVVLRCHAVLLARAHKARALARLLRQTALAAF 202

  Fly   196 AVCLERKQRRDKECGVTMTFDTKNSTFTRTGSFRQQTLTERLAMATVGTNERSVDGPGSAMPGPP 260
            : ..:|.||:.         |.::        .|||.|              ...|..:::|..|
Human   203 S-DFKRLQRQS---------DARH--------VRQQHL--------------RAGGAAASVPRAP 235

  Fly   261 AATVK----PFNPFAIERPHATPNMLERQSSFRLSTI 293
            ...:.    .:.|...||....|         |||:|
Human   236 LRRLLNAKCAYRPPPSERSRGAP---------RLSSI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
numbNP_001260291.1 PTB_Numb 67..201 CDD:241298 26/174 (15%)
NumbF 269..374 CDD:283874 8/25 (32%)
FAM43BNP_997217.1 PH-like 71..263 CDD:418428 44/255 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..329 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141150
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.