Sequence 1: | NP_001260291.1 | Gene: | numb / 34263 | FlyBaseID: | FBgn0002973 | Length: | 556 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031756343.1 | Gene: | mapk8ip1 / 100496373 | XenbaseID: | XB-GENE-478437 | Length: | 680 | Species: | Xenopus tropicalis |
Alignment Length: | 226 | Identity: | 50/226 - (22%) |
---|---|---|---|
Similarity: | 91/226 - (40%) | Gaps: | 61/226 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 GKFGDVKNGKS------ASFRFSKKSPKKMD---------------------RLRRSFRDSF--- 53
Fly 54 -----RRRKDRVPESSKPHQWQADEEAVRSATCSFSVKYLGCVEVFESRGMQVCEEALKVLRQSR 113
Fly 114 R------RPVRGLLHVSGDGLRVVDDETKGLIVDQT--------IEKVSFCAPDRNHERGFSYIC 164
Fly 165 RDGTTRRWMCHGFLACKDSGERLSHAVGCAF 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
numb | NP_001260291.1 | PTB_Numb | 67..201 | CDD:241298 | 34/143 (24%) |
NumbF | 269..374 | CDD:283874 | |||
mapk8ip1 | XP_031756343.1 | SH3_JIP1 | 461..515 | CDD:212876 | 8/53 (15%) |
PTB_JIP | 531..680 | CDD:269923 | 34/141 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |