DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment numb and mapk8ip1

DIOPT Version :9

Sequence 1:NP_001260291.1 Gene:numb / 34263 FlyBaseID:FBgn0002973 Length:556 Species:Drosophila melanogaster
Sequence 2:XP_031756343.1 Gene:mapk8ip1 / 100496373 XenbaseID:XB-GENE-478437 Length:680 Species:Xenopus tropicalis


Alignment Length:226 Identity:50/226 - (22%)
Similarity:91/226 - (40%) Gaps:61/226 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GKFGDVKNGKS------ASFRFSKKSPKKMD---------------------RLRRSFRDSF--- 53
            |.|..:.||:.      |.|||..:.|.:::                     .:|...|..|   
 Frog   447 GLFSCLINGEEREQTHRAVFRFMPRHPDELELEVEDPLLVEVQAEDYWYEAYNMRTGERGIFPAY 511

  Fly    54 -----RRRKDRVPESSKPHQWQADEEAVRSATCSFSVKYLGCVEVFESRGMQVCEEALKVLRQSR 113
                 .:..|.:.||..|: | .|:         |.:|:||.|:|...:|..|...|::.:..||
 Frog   512 YAVQVTKEPDPIAESRAPN-W-VDQ---------FWLKFLGSVQVPYHKGTDVLCTAMQKIAVSR 565

  Fly   114 R------RPVRGLLHVSGDGLRVVDDETKGLIVDQT--------IEKVSFCAPDRNHERGFSYIC 164
            |      .|...:|.:|..|:::.......|...|.        ::.:|||:....:.:.|.:|.
 Frog   566 RLTVLSNPPANCILEISMRGVKIAVQGEDPLDHSQVNTCSHFFQLKNISFCSYHPKNSKYFGFIT 630

  Fly   165 RDGTTRRWMCHGFLACKDSGERLSHAVGCAF 195
            :..:..|:.||.|:: ::|.:.|:.::|.||
 Frog   631 KHPSDHRFACHVFVS-EESTKPLAESIGRAF 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
numbNP_001260291.1 PTB_Numb 67..201 CDD:241298 34/143 (24%)
NumbF 269..374 CDD:283874
mapk8ip1XP_031756343.1 SH3_JIP1 461..515 CDD:212876 8/53 (15%)
PTB_JIP 531..680 CDD:269923 34/141 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.