DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment numb and LOC100361087

DIOPT Version :9

Sequence 1:NP_001260291.1 Gene:numb / 34263 FlyBaseID:FBgn0002973 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001177388.1 Gene:LOC100361087 / 100361087 RGDID:2320873 Length:292 Species:Rattus norvegicus


Alignment Length:370 Identity:73/370 - (19%)
Similarity:105/370 - (28%) Gaps:153/370 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 CAFAVCLERKQRRDKECGVTMTFDTKNSTFTRT---GSFR--QQTLTERL-------------AM 239
            |.|.:|                |......|:||   ..|.  ..|||.:|             |.
  Rat     2 CLFLIC----------------FPPAFEPFSRTVDHSMFENLNTTLTPKLQSSHSFPHLSRPGAP 50

  Fly   240 ATVGTNERSVDGPGSAMPGPPAATVKPFNPFAIERPH----------ATPNMLERQSSFRLSTIG 294
            .|:        .|||..||.|...|.       ...|          ...::|.|:.|..|.::|
  Rat    51 GTI--------TPGSGEPGGPGLRVG-------SSQHLRNLGKAVGAKVNDLLRRKESSSLGSVG 100

  Fly   295 SQSPFKRQMSLRINDLPSNADRQRAFLTAAAGNPMQTPLRSVS---PIAEVSPAKSAGADPLSAA 356
                        :.::...|:.|......||..|.....|||.   |:.:..|..:....|    
  Rat   101 ------------VMEINKTAEAQMPGGEDAACGPWLEDERSVQEAFPLLDPPPPITRKRTP---- 149

  Fly   357 AVAADSVSQLCQELSQGLSLLTQTDALLAAGEDLNFNNNRSINQNIIAAEKQVQHVHSYAPPTAQ 421
                             .:|.|..|.|:::...|   :|......:...:.|      .:|||||
  Rat   150 -----------------RALKTTQDMLISSQPVL---SNLEYGTELSPGQAQ------DSPPTAQ 188

  Fly   422 V----TPRVASTT---------PTYQT-------LHSQSPSRSEQSIETSTE------------- 453
            .    |.|..|||         |..:.       :|..|   .|:|...:||             
  Rat   189 PVSADTSRPESTTGMGEKGEALPNGEVSLLVPDLIHKNS---QEESKRKATEGRKSSSPGPIERN 250

  Fly   454 --------LPNAEQWLGHVVRSTSPAAPKRPTYLANVGRAQTLAS 490
                    :..||.|     .::||....|.:.|.|.|....|.|
  Rat   251 GLKLSLSPISLAESW-----ENSSPPLQARTSSLENEGLHPDLLS 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
numbNP_001260291.1 PTB_Numb 67..201 CDD:241298 3/7 (43%)
NumbF 269..374 CDD:283874 17/117 (15%)
LOC100361087NP_001177388.1 DUF4628 23..292 CDD:292069 66/333 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334822
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.