DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment numb and mapk8ip2

DIOPT Version :9

Sequence 1:NP_001260291.1 Gene:numb / 34263 FlyBaseID:FBgn0002973 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001090670.1 Gene:mapk8ip2 / 100036643 XenbaseID:XB-GENE-484342 Length:1016 Species:Xenopus tropicalis


Alignment Length:249 Identity:54/249 - (21%)
Similarity:90/249 - (36%) Gaps:61/249 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GNSSSHTHEPLERGFTR---------------GKFGDVKNGKS------ASFRFSKKSPKKMDRL 45
            |:||...:.|..:.|..               |.|..|.||:.      |.|||   .|:..|.|
 Frog   754 GDSSPEPNMPFSKKFLNVFVNSTSRSSSTDSFGLFSCVINGEEREQTHRAVFRF---IPRHEDEL 815

  Fly    46 RRSFRD---------------SFRRRKDRVPESSKPHQ--WQADEEAVRSATC----SFSVKYLG 89
            .....|               :.|..:..:..|...|:  ....|..|.....    .|..::||
 Frog   816 ELDVDDPLLVECEDGSWCRGYNMRTGERGIFPSFYAHEVVCPVKENVVLRGNSPWVQMFDAQFLG 880

  Fly    90 CVEVFESRGMQVCEEALKVLRQSR------RRPVRGLLHVSGDGLRVV-------DDETKGLIVD 141
            .|||...:|..:...|::.:..:|      |.|....|.:|..|::::       :||.......
 Frog   881 SVEVPNHQGNGILCAAMQKIATARKLTVHLRPPASCELEISLRGVKLILRGNDRPEDERCSHFFQ 945

  Fly   142 QTIEKVSFCAPDRNHERGFSYICRDGTTRRWMCHGFLACKDSGERLSHAVGCAF 195
              ::.:|||.....:...|.:|.:.....|:.||.|:: :||..|::..:|.||
 Frog   946 --MKNISFCGCHPRNSCYFGFITKHPVLNRFACHVFVS-QDSMRRVAECLGRAF 996

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
numbNP_001260291.1 PTB_Numb 67..201 CDD:241298 34/148 (23%)
NumbF 269..374 CDD:283874
mapk8ip2NP_001090670.1 SH3 800..853 CDD:302595 10/55 (18%)
PTB_JIP 870..1016 CDD:269923 31/130 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.