DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTB and FucTA

DIOPT Version :9

Sequence 1:NP_001285779.1 Gene:FucTB / 34260 FlyBaseID:FBgn0032117 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001261872.1 Gene:FucTA / 39653 FlyBaseID:FBgn0036485 Length:503 Species:Drosophila melanogaster


Alignment Length:320 Identity:92/320 - (28%)
Similarity:146/320 - (45%) Gaps:59/320 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 WSENII--------NYENIKFNSPVELVWWSRDMS-WNY----DV--QRQCGIHTCRITNKRSRR 74
            :|:.||        |||.||.:..::.:.....:. ||.    ||  :.:|.:.||.:|..|...
  Fly   150 YSDRIINQLMYVPHNYEEIKSSGKLKTILLYNGLGPWNVKKGRDVFLKAKCPVDTCELTANRDLA 214

  Fly    75 PWARGVLFYGSNIKTGDFPLPRNEHQIWALLHEESPRNTPFVSNKEFLRHFHFTSTFSRYSNLPL 139
            ..|..:|:....|.|| ...|.|..|:..|.:.|.|.:|..|...:.:   ::|:|:.|.|    
  Fly   215 STADMILYKDHYIPTG-IRRPSNSKQVSMLYYLECPYHTQNVKVPDAI---NWTATYRRDS---- 271

  Fly   140 TTMYLPSGEALTSKDYYVT----FDGKSKYGYRPSTSVVFLQSDCDTMSGREDYVKELMKHLPID 200
             |:..|    .....||.|    .:....|....:..|.:..|:|...:||..|..||.|::.:|
  Fly   272 -TIVAP----YEKWQYYDTKVQQQEQDINYSVNKTKKVAWFVSNCGARNGRLQYAHELQKYIEVD 331

  Fly   201 SYGSCLRNRDLPESLQKDYLNNLYSPELLRFLSEYKFMIAIENAACPDYITEKFW--------RP 257
            .||:|...:....:..|.:       |:|.  ::|||.:|.||:.|.|||||||:        .|
  Fly   332 IYGACGNFKCSRSTADKCF-------EILD--NDYKFYLAFENSNCKDYITEKFFVNALNRRVLP 387

  Fly   258 LIMGVIPIYFGSPTIKDWEPN--NKSAIFVNDFQNPQALVEYLNKLADNKKLYNSYRQHK 315
            ::||..|        :|:|.:  .:|.|.|::|.:|:.|.|||..|..:.:|||||.:.|
  Fly   388 IVMGARP--------EDYEVSAPRRSYIHVDEFSSPKELAEYLRILDHDDELYNSYFKWK 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTBNP_001285779.1 Glyco_tran_10_N <61..139 CDD:293644 21/77 (27%)
Glyco_transf_10 178..314 CDD:279224 50/145 (34%)
FucTANP_001261872.1 Glyco_tran_10_N 173..277 CDD:293644 28/116 (24%)
Glyco_transf_10 300..473 CDD:279224 52/157 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2619
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D551308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1184
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11929
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X114
65.920

Return to query results.
Submit another query.