DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbp2 and Hpgd

DIOPT Version :9

Sequence 1:NP_001285777.1 Gene:Fbp2 / 34259 FlyBaseID:FBgn0000640 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_077366.2 Gene:Hpgd / 79242 RGDID:620087 Length:266 Species:Rattus norvegicus


Alignment Length:236 Identity:66/236 - (27%)
Similarity:112/236 - (47%) Gaps:17/236 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GKNVVYVGSFSGIGWQMMMQLMQKDIKMMGIMHRME-NVKMMKKLQAINPSVKVVFMQMNLMEKM 69
            ||..:..|:..|||......|:....|:..:...:| .||....|.......|.:|:|.::.::.
  Rat     5 GKVALVTGAAQGIGKAFTEALLLHGAKVALVDWNLETGVKCKAALDEQFEPQKTLFIQCDVADQK 69

  Fly    70 SIEQAMKKMGQMMGHIDVMINGEGVLLDKDVETTMGMNLTGMIQSTMMAMPYMDKTQMGMGGMVV 134
            .:....:|:....|.:|:::|..||..:|:.|.|:.:||..:|..|.:.:.||.|...|.||:::
  Rat    70 QLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEQTLQINLVSVISGTYLGLDYMSKQNGGEGGIII 134

  Fly   135 NMSSVYGLEPAPAFSVYAAAMHGILGFTRSMGDKMIYQKTGVMFMAMCPGLTNSEMIMNLRDNVT 199
            |:||:.||.|.....||.|:.|||:|||||........|:||....:|||...:.::.::     
  Rat   135 NISSIAGLMPVAQQPVYCASKHGIIGFTRSAAMAANLMKSGVRLNVICPGFVKTPILESI----- 194

  Fly   200 WHHSESM---VEAIESAKRQM-------PEEAAMQMIHAME 230
             ...|:|   :|..:..|..|       |...|..:|:.:|
  Rat   195 -EKEENMGQYIEYTDQIKAMMKFYGILDPSAIANGLINLIE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbp2NP_001285777.1 ADH_SDR_c_like 7..249 CDD:187584 65/235 (28%)
adh_short 7..198 CDD:278532 56/191 (29%)
HpgdNP_077366.2 ADH_SDR_c_like 6..254 CDD:187584 65/235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344851
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053465at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44427
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44229
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.